PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015873960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 629aa    MW: 72007.2 Da    PI: 6.7311
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015873960.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS366.53.7e-1122516261374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+ lL++cAeav+ +d e a++lL+++++++s  g+++qRla  f++AL arl++++se+y+al++++ s   ++++l+a +lf  +sP++k s+
  XP_015873960.1 251 LRALLTNCAEAVAVNDRESANELLTQIRQHSSCFGNSTQRLAYAFANALDARLSGTGSEVYRALNAKKLS---MVDKLKACRLFLSASPFIKTSN 342
                     5789*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     +++Nq+Ile +e+++++Hii f+i++G+QWp+L+q L++R++gpp lRiTg++ p++g   + ++eetg+ Lak++++++vpfe+n l+a+r+e+
  XP_015873960.1 343 FLTNQTILELAEKANTIHIIHFGIGNGFQWPSLIQRLSKRQGGPPLLRITGIDLPSPGfrPEARVEETGKYLAKYCKRFNVPFEYNSLIAERWET 437
                     *********************************************************9*9*********************************** PP

            GRAS 189 leleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres.e 280
                     +  e+L++++  +E+++Vn+ ++  +llde+v+++++rd vL+l+ +++P+++v+     +++++ F+ rf eal+++sa fd++ea+  +++ +
  XP_015873960.1 438 ILCENLKINQrrDEVTVVNCLYRFRHLLDETVTSNNPRDGVLNLISRINPDIFVHGVISGSYDAPFFMSRFKEALHHFSAEFDMMEASSDSQEdK 532
                     ********9999*************************************************************************777655445* PP

            GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +ri+ E+e+ g ei nv+aceg er+er e +++W+ r ++aG++++pl+ +++k++k  +   + + + v+e+ +++++gWk+r L+++S+W+
  XP_015873960.1 533 DRIVFEQEVYGMEILNVIACEGIERIERPEMYKQWQFRHQRAGLRQLPLNREVMKKVKEQVMSNYHKDFVVDEDGEWMLQGWKGRILYALSCWK 626
                     **********************************************************9999999888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.617225606IPR005202Transcription factor GRAS
PfamPF035141.3E-109251626IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MSNRREEEII LNSISQILLE EDLEDETTTD MFSNAKLEAA ERSFYDVLAQ KFRSPSSTSN  60
IAPLIINSLN SQIDDRQYYT SIYSNNDAMV SDLHHNSSYN NIPALVLPNF YSNSSESFCS  120
SATSKPPRTG FIEKNNTLIP DLELNRTSST ISFHHLSSAL RKRKNHHQPT ESHESERERN  180
NNYKHLALYP EHQSDKFIDL FDKVLLSNGE DSSSLELSTN HQINIGQSKG CVIGGSVRRK  240
KQVNIEDLVD LRALLTNCAE AVAVNDRESA NELLTQIRQH SSCFGNSTQR LAYAFANALD  300
ARLSGTGSEV YRALNAKKLS MVDKLKACRL FLSASPFIKT SNFLTNQTIL ELAEKANTIH  360
IIHFGIGNGF QWPSLIQRLS KRQGGPPLLR ITGIDLPSPG FRPEARVEET GKYLAKYCKR  420
FNVPFEYNSL IAERWETILC ENLKINQRRD EVTVVNCLYR FRHLLDETVT SNNPRDGVLN  480
LISRINPDIF VHGVISGSYD APFFMSRFKE ALHHFSAEFD MMEASSDSQE DKDRIVFEQE  540
VYGMEILNVI ACEGIERIER PEMYKQWQFR HQRAGLRQLP LNREVMKKVK EQVMSNYHKD  600
FVVDEDGEWM LQGWKGRILY ALSCWKPAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-362556268375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015873960.10.0PREDICTED: scarecrow-like protein 33
TrEMBLF6HLC10.0F6HLC1_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g00510.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-147SCARECROW-like 14